- Hydraulics - Pneumatics
- Pump
- Alcohol pump
- CSF Inox Spa
Alcohol pump CL-CLC serieswheyelectricself-priming
Add to favorites
Compare this product
Characteristics
- Fluid
- alcohol, whey
- Operation
- electric
- Priming
- self-priming
- Technology
- vane
- Mobility
- stationary
- Domain
- industrial, for the food and beverage industry, for the pharmaceutical industry, for the cosmetics industry
- Applications
- transfer, washing
- Material
- stainless steel
- Other characteristics
- open
- Flow
Max.: 2,000 l/min
(528.3441 us gal/min)Min.: 0 l/min
(0 us gal/min)- Head
Max.: 40 m
(131'02" )Min.: 0 m
(0'00" )- Length
Max.: 610 mm
(24 in)Min.: 392 mm
(15 in)- Width
Max.: 300 mm
(11.81 in)Min.: 141 mm
(5.55 in)- Height
Max.: 332 mm
(13.07 in)Min.: 166 mm
(6.54 in)
Description
CL Made with an open three-vane impeller installed directly on the motor shaft for use in a wide range of applications. Made entirely from AISI 316L polished stainless steel, these pumps guarantee a high level of hygiene and consequently can be used for the low pressure transfer of juices, creams, ice-cream, dairy cream, milk, wine, alcohol and whey.
CLC With the same features as the “CL” series but with a closed impeller, these pumps are used to transfer clean liquids with medium/high heads (max. 30-50 m) and to deliver liquids to pasteurizers, coolers, concentration filters, washing circuits.
Catalogs
No catalogs are available for this product.
See all of CSF Inox Spa‘s catalogs
Related Searches
*Prices are pre-tax. They exclude delivery charges and customs duties and do not include additional charges for installation or activation options. Prices are indicative only and may vary by country, with changes to the cost of raw materials and exchange rates.