- Hydraulics - Pneumatics
- Pump
- Oil pump
- InoxMIMGrup S.L.
Oil pump FL-AL serieswheyelectricself-priming
Add to favorites
Compare this product
Characteristics
- Fluid
- whey, oil
- Operation
- electric
- Priming
- self-priming
- Technology
- liquid ring
- Mobility
- stationary
- Domain
- industrial, chemical
- Applications
- handling, work
- Voltage
- 24 V, 230 V, 240 V
- Other characteristics
- multiphase
- Flow
30 m³/h
(1,059.44 ft³/h)
Description
Liquid Ring Pump FL-AL
FL-AL liquid ring pumps have been designed for transferring and handling clean fluids and fluids without any suspended solid particles. This kind of self-priming, reversible pump can work with a wide range of products and fields, such as the wine and oil industries (wines, must, vinegar and olive oil), dairy products industry (milk, whey, etc.) and chemical industry (acids, solvents, detergents, inks, etc.).
Catalogs
Pumping systems
84 Pages
Related Searches
- Pump
- Industrial pump
- Pump with electric motor
- Stationary pump
- Clear water pump
- Centrifugal pump
- Self-priming pump
- Chemical pump
- Stainless steel pump
- Lubricant pump
- Transfer pump
- Chemistry pump
- Suction pump
- Lubricating oil pump
- Compact pump
- Flow pump
- Mechanically-actuated pump
- Food product pump
- Impeller pump
- Discharge pump
*Prices are pre-tax. They exclude delivery charges and customs duties and do not include additional charges for installation or activation options. Prices are indicative only and may vary by country, with changes to the cost of raw materials and exchange rates.